Lineage for d2v48p1 (2v48 P:1-83)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070170Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1070283Domain d2v48p1: 2v48 P:1-83 [152534]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48m1, d2v48n1, d2v48q1, d2v48r1, d2v48t1, d2v48u1, d2v48y1
    automatically matched to d1ibkp_
    complexed with mg, zn

Details for d2v48p1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2v48p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48p1 i.1.1.1 (P:1-83) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2v48p1:

Click to download the PDB-style file with coordinates for d2v48p1.
(The format of our PDB-style files is described here.)

Timeline for d2v48p1: