Lineage for d2v48k1 (2v48 K:11-126)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2140543Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2140544Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2140634Protein Ribosomal protein S11 [53141] (2 species)
  7. 2140660Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 2140692Domain d2v48k1: 2v48 K:11-126 [152529]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v48k1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2v48k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48k1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr

SCOPe Domain Coordinates for d2v48k1:

Click to download the PDB-style file with coordinates for d2v48k1.
(The format of our PDB-style files is described here.)

Timeline for d2v48k1: