SCOPe 2.01: Domain d2v4771: 2v47 7:1-49

Lineage for d2v4771 (2v47 7:1-49)

1. Root: SCOPe 2.01

2. Class j: Peptides [58231] (120 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries)
   Uniprot P80340 1-49

8. Domain d2v4771: 2v47 7:1-49 [152508]
   Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1
   automatically matched to 2J01 7:1-49

Details for d2v4771

PDB Entry: 2v47, 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2v4771:

Sequence; same for both SEQRES and ATOM records:

>d2v4771 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

Timeline for d2v4771:

• d2v4771 first appeared in SCOP 1.75
  
• d2v4771 appears in SCOPe 2.02
  
• d2v4771 appears in the current release, SCOPe 2.08