Lineage for d2v4751 (2v47 5:2-60)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641696Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2641848Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2641849Protein Ribosomal protein L32p [144201] (3 species)
  7. 2641885Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 2641888Domain d2v4751: 2v47 5:2-60 [152506]
    Other proteins in same PDB: d2v4741, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v4751

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2v4751:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4751 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2v4751:

Click to download the PDB-style file with coordinates for d2v4751.
(The format of our PDB-style files is described here.)

Timeline for d2v4751: