![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
![]() | Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins) |
![]() | Protein Ribosome recycling factor, RRF [55196] (7 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries) |
![]() | Domain d2v46y1: 2v46 Y:1-185 [152504] Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v46 (more details), 3.8 Å
SCOPe Domain Sequences for d2v46y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v46y1 d.67.3.1 (Y:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke qeilg
Timeline for d2v46y1: