Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d2v46h1: 2v46 H:1-138 [152490] Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1 automatically matched to d1fjgh_ complexed with mg, zn |
PDB Entry: 2v46 (more details), 3.8 Å
SCOPe Domain Sequences for d2v46h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v46h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2v46h1: