Lineage for d2v46h1 (2v46 H:1-138)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873626Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 873627Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 873628Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 873629Protein Ribosomal protein S8 [56049] (4 species)
  7. 873647Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 873680Domain d2v46h1: 2v46 H:1-138 [152490]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    automatically matched to d1fjgh_
    complexed with 5mu, mg, zn

Details for d2v46h1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2v46h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d2v46h1:

Click to download the PDB-style file with coordinates for d2v46h1.
(The format of our PDB-style files is described here.)

Timeline for d2v46h1: