Lineage for d2v46d1 (2v46 D:2-209)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563589Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2563590Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2563591Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2563592Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2563623Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 2563654Domain d2v46d1: 2v46 D:2-209 [152486]
    Other proteins in same PDB: d2v46b1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v46d1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2v46d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2v46d1:

Click to download the PDB-style file with coordinates for d2v46d1.
(The format of our PDB-style files is described here.)

Timeline for d2v46d1: