Lineage for d2v3ya2 (2v3y A:177-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538142Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2538143Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2538145Domain d2v3ya2: 2v3y A:177-440 [152480]
    Other proteins in same PDB: d2v3ya1
    automatically matched to d1a16a2
    complexed with cl, mn

Details for d2v3ya2

PDB Entry: 2v3y (more details), 1.6 Å

PDB Description: his361ala escherichia coli aminopeptidase p in complex with product
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2v3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3ya2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvadvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2v3ya2:

Click to download the PDB-style file with coordinates for d2v3ya2.
(The format of our PDB-style files is described here.)

Timeline for d2v3ya2: