SCOP 1.75: Domain d2v3wb2: 2v3w B:2-181

Lineage for d2v3wb2 (2v3w B:2-181)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Benzoylformate decarboxylase [88731] (1 species)

7. Species Pseudomonas putida [TaxId:303] [88732] (9 PDB entries)
   Uniprot P20906

8. Domain d2v3wb2: 2v3w B:2-181 [152469]
   Other proteins in same PDB: d2v3wa1, d2v3wa3, d2v3wb1, d2v3wb3, d2v3wc1, d2v3wc3, d2v3wd1, d2v3wd3
   automatically matched to d1bfda2
   complexed with mg, so4, tpp; mutant

Details for d2v3wb2

PDB Entry: 2v3w, 2.2 Å

PDB Description: crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida

PDB Compounds: (B:) Benzoylformate decarboxylase

SCOP Domain Sequences for d2v3wb2:

Sequence; same for both SEQRES and ATOM records:

>d2v3wb2 c.36.1.5 (B:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

Timeline for d2v3wb2:

• d2v3wb2 is new in SCOP 1.75
  
• d2v3wb2 appears in SCOPe 2.01
  
• d2v3wb2 appears in the current release, SCOPe 2.08