Lineage for d2v3va2 (2v3v A:3-600)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621793Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1621794Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 1621795Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 1621909Protein automated matches [227025] (4 species)
    not a true protein
  7. 1621910Species Desulfovibrio desulfuricans [TaxId:876] [255265] (3 PDB entries)
  8. 1621911Domain d2v3va2: 2v3v A:3-600 [152464]
    Other proteins in same PDB: d2v3va1
    automated match to d2napa2
    complexed with lcp, mgd, mo, sf4, unx

Details for d2v3va2

PDB Entry: 2v3v (more details), 1.99 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2v3va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3va2 c.81.1.1 (A:3-600) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
nrpekwvkgvcrycgtgcgvlvgvkdgkavaiqgdpnnhnagllclkgsllipvlnsker
vtqplvrrhkggklepvswdealdlmasrfrssidmygpnsvawygsgqclteesyvank
ifkggfgtnnvdgnprlcmasavggyvtsfgkdepmgtyadidqatcffiigsntseahp
vlfrriarrkqvepgvkiivadprrtntsriadmhvafrpgtdlafmhsmawviineeld
nprfwqryvnfmdaegkpsdfegykaflenyrpekvaeicrvpveqiygaarafaesaat
mslwcmginqrvqgvfannlihnlhlitgqicrpgatsfsltgqpnacggvrdggalshl
lpagraipnakhraemeklwglpegriapepgyhtvalfealgrgdvkcmiicetnpaht
lpnlnkvhkamshpesfivcieafpdavtleyadlvlppafwcerdgvygcgerryslte
kavdppgqcrptvntlvefarragvdpqlvnfrnaedvwnewrmvskgttydfwgmtrer
lrkesgliwpcpsedhpgtslryvrgqdpcvpadhpdrfffygkpdgraviwmrpakg

SCOPe Domain Coordinates for d2v3va2:

Click to download the PDB-style file with coordinates for d2v3va2.
(The format of our PDB-style files is described here.)

Timeline for d2v3va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v3va1