Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (97 PDB entries) |
Domain d2hhbc_: 2hhb C: [15246] Other proteins in same PDB: d2hhbb_, d2hhbd_ complexed with hem, po4 |
PDB Entry: 2hhb (more details), 1.74 Å
SCOP Domain Sequences for d2hhbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhbc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d2hhbc_: