Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (43 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries) |
Domain d2v2tb1: 2v2t B:251-350 [152425] Other proteins in same PDB: d2v2ta1, d2v2tb2 automated match to d1ooaa1 protein/DNA complex |
PDB Entry: 2v2t (more details), 3.05 Å
SCOPe Domain Sequences for d2v2tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v2tb1 b.1.18.0 (B:251-350) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv fktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d2v2tb1: