Lineage for d2v2tb1 (2v2t B:251-350)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771244Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)
  8. 1771255Domain d2v2tb1: 2v2t B:251-350 [152425]
    Other proteins in same PDB: d2v2ta1, d2v2tb2
    automated match to d1ooaa1
    protein/DNA complex

Details for d2v2tb1

PDB Entry: 2v2t (more details), 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex
PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2v2tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2tb1 b.1.18.0 (B:251-350) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d2v2tb1:

Click to download the PDB-style file with coordinates for d2v2tb1.
(The format of our PDB-style files is described here.)

Timeline for d2v2tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v2tb2