SCOPe 2.03: Domain d2v2ia_: 2v2i A:

Lineage for d2v2ia_ (2v2i A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (46 PDB entries)

8. Domain d2v2ia_: 2v2i A: [152423]
   automated match to d1data_
   complexed with cd, gol, so4

Details for d2v2ia_

PDB Entry: 2v2i, 2 Å

PDB Description: wild type recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions

PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2ia_:

Sequence; same for both SEQRES and ATOM records:

>d2v2ia_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

Timeline for d2v2ia_:

• d2v2ia_ first appeared in SCOP 1.75, called d2v2ia1
  
• d2v2ia_ appears in SCOPe 2.02
  
• d2v2ia_ appears in SCOPe 2.04
  
• d2v2ia_ appears in the current release, SCOPe 2.08