SCOP 1.59: Domain d1bzzc_: 1bzz C:

Lineage for d1bzzc_ (1bzz C:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (78 PDB entries)

8. Domain d1bzzc_: 1bzz C: [15240]
   Other proteins in same PDB: d1bzzb_, d1bzzd_

Details for d1bzzc_

PDB Entry: 1bzz, 1.59 Å

PDB Description: hemoglobin (alpha v1m) mutant

SCOP Domain Sequences for d1bzzc_:

Sequence; same for both SEQRES and ATOM records:

>d1bzzc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1bzzc_:

• d1bzzc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzzc_ appears in SCOP 1.57
  
• d1bzzc_ appears in SCOP 1.61
  
• d1bzzc_ appears in the current release, SCOPe 2.08