SCOP 1.75: Domain d2v0na3: 2v0n A:294-454

Lineage for d2v0na3 (2v0n A:294-454)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.2: GGDEF domain [117984] (1 protein)
   Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain

6. Protein Response regulator PleD, C-terminal domain [117985] (1 species)
   Diguanylate cyclase

7. Species Caulobacter crescentus [TaxId:155892] [117986] (2 PDB entries)
   Uniprot Q9A5I5

8. Domain d2v0na3: 2v0n A:294-454 [152367]
   Other proteins in same PDB: d2v0na1, d2v0na2, d2v0nb1, d2v0nb2
   automatically matched to d1w25a3
   complexed with 5gp, bef, cl, gav, mg, so4

Details for d2v0na3

PDB Entry: 2v0n, 2.71 Å

PDB Description: activated response regulator pled in complex with c-digmp and gtp- alpha-s

PDB Compounds: (A:) response regulator pled

SCOP Domain Sequences for d2v0na3:

Sequence; same for both SEQRES and ATOM records:

>d2v0na3 d.58.29.2 (A:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}
ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr
lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti
sigvsatagegdtpeallkradegvyqakasgrnavvgkaa

Timeline for d2v0na3:

• d2v0na3 is new in SCOP 1.75
  
• d2v0na3 appears in SCOPe 2.01
  
• d2v0na3 appears in the current release, SCOPe 2.08