Lineage for d1babc_ (1bab C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 136Species Human (Homo sapiens) [TaxId:9606] [46487] (73 PDB entries)
  8. 138Domain d1babc_: 1bab C: [15236]
    Other proteins in same PDB: d1babb_, d1babd_

Details for d1babc_

PDB Entry: 1bab (more details), 1.5 Å

PDB Description: hemoglobin thionville: an alpha-chain variant with a substitution of a glutamate for valine at na-1 and having an acetylated methionine nh2 terminus

SCOP Domain Sequences for d1babc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1babc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
melspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghg
kkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftp
avhasldkflasvstvltskyr

SCOP Domain Coordinates for d1babc_:

Click to download the PDB-style file with coordinates for d1babc_.
(The format of our PDB-style files is described here.)

Timeline for d1babc_: