Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (8 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries) Uniprot P20248 175-432 |
Domain d2uzeb1: 2uze B:181-308 [152343] automatically matched to d1vina1 complexed with c95 |
PDB Entry: 2uze (more details), 2.4 Å
SCOP Domain Sequences for d2uzeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzeb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2uzeb1: