Lineage for d1d8ub_ (1d8u B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301843Protein Non-symbiotic plant hemoglobin [46484] (1 species)
  7. 2301844Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)
  8. 2301846Domain d1d8ub_: 1d8u B: [15234]
    complexed with hem

Details for d1d8ub_

PDB Entry: 1d8u (more details), 2.35 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice
PDB Compounds: (B:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d1d8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ub_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

SCOPe Domain Coordinates for d1d8ub_:

Click to download the PDB-style file with coordinates for d1d8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ub_: