SCOP 1.71: Domain d1d8ub_: 1d8u B:

Lineage for d1d8ub_ (1d8u B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Non-symbiotic plant hemoglobin [46484] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [46485] (1 PDB entry)

8. Domain d1d8ub_: 1d8u B: [15234]
   complexed with hem

Details for d1d8ub_

PDB Entry: 1d8u, 2.35 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice

SCOP Domain Sequences for d1d8ub_:

Sequence; same for both SEQRES and ATOM records:

>d1d8ub_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa)}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

Timeline for d1d8ub_:

• d1d8ub_ first appeared (with stable ids) in SCOP 1.55
  
• d1d8ub_ appears in SCOP 1.69
  
• d1d8ub_ appears in SCOP 1.73
  
• d1d8ub_ appears in the current release, SCOPe 2.08