Lineage for d1d8ub_ (1d8u B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44699Protein Non-symbiotic plant hemoglobin [46484] (1 species)
  7. 44700Species Rice (Oryza sativa) [TaxId:4530] [46485] (1 PDB entry)
  8. 44702Domain d1d8ub_: 1d8u B: [15234]

Details for d1d8ub_

PDB Entry: 1d8u (more details), 2.35 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice

SCOP Domain Sequences for d1d8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ub_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa)}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

SCOP Domain Coordinates for d1d8ub_:

Click to download the PDB-style file with coordinates for d1d8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ub_: