Lineage for d2uzab1 (2uza B:2-258)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473045Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
    automatically mapped to Pfam PF01855
  6. 2473046Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)
  7. 2473047Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries)
  8. 2473063Domain d2uzab1: 2uza B:2-258 [152330]
    Other proteins in same PDB: d2uzaa2, d2uzaa3, d2uzaa4, d2uzaa5, d2uzab2, d2uzab3, d2uzab4, d2uzab5
    automated match to d1keka1
    complexed with ca, co2, htl, mg, sf4

Details for d2uzab1

PDB Entry: 2uza (more details), 2.42 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate ferredoxin oxidoreductase

SCOPe Domain Sequences for d2uzab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzab1 c.36.1.8 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOPe Domain Coordinates for d2uzab1:

Click to download the PDB-style file with coordinates for d2uzab1.
(The format of our PDB-style files is described here.)

Timeline for d2uzab1: