Lineage for d1binb_ (1bin B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759552Protein Leghemoglobin [46481] (2 species)
  7. 759553Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)
  8. 759557Domain d1binb_: 1bin B: [15232]
    complexed with act, hem, so4

Details for d1binb_

PDB Entry: 1bin (more details), 2.2 Å

PDB Description: leghemoglobin a (acetomet)
PDB Compounds: (B:) leghemoglobin a

SCOP Domain Sequences for d1binb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1binb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

SCOP Domain Coordinates for d1binb_:

Click to download the PDB-style file with coordinates for d1binb_.
(The format of our PDB-style files is described here.)

Timeline for d1binb_: