Lineage for d2uxmm_ (2uxm M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255521Protein automated matches [190224] (9 species)
    not a true protein
  7. 2255540Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries)
  8. 2255588Domain d2uxmm_: 2uxm M: [152309]
    Other proteins in same PDB: d2uxmh1, d2uxmh2
    automated match to d1ystm_
    complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uxmm_

PDB Entry: 2uxm (more details), 2.7 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the charge-separated state, 2nd dataset
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2uxmm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxmm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOPe Domain Coordinates for d2uxmm_:

Click to download the PDB-style file with coordinates for d2uxmm_.
(The format of our PDB-style files is described here.)

Timeline for d2uxmm_: