SCOPe 2.02: Domain d2uxmm_: 2uxm M:

Lineage for d2uxmm_ (2uxm M:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries)

8. Domain d2uxmm_: 2uxm M: [152309]
   automated match to d1ystm_
   complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uxmm_

PDB Entry: 2uxm, 2.7 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the charge-separated state, 2nd dataset

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2uxmm_:

Sequence; same for both SEQRES and ATOM records:

>d2uxmm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

Timeline for d2uxmm_:

• d2uxmm_ first appeared in SCOP 1.75, called d2uxmm1
  
• d2uxmm_ appears in SCOPe 2.01
  
• d2uxmm_ appears in SCOPe 2.03
  
• d2uxmm_ appears in the current release, SCOPe 2.08