SCOPe 2.08: Domain d1fslb_: 1fsl B:

Lineage for d1fslb_ (1fsl B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)

8. Domain d1fslb_: 1fsl B: [15230]
   complexed with hem, nio

Details for d1fslb_

PDB Entry: 1fsl, 2.3 Å

PDB Description: ferric soybean leghemoglobin complexed with nicotinate

PDB Compounds: (B:) leghemoglobin a

SCOPe Domain Sequences for d1fslb_:

Sequence; same for both SEQRES and ATOM records:

>d1fslb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

Timeline for d1fslb_:

• d1fslb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fslb_ appears in SCOPe 2.07