Lineage for d2uxdn1 (2uxd N:2-61)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262561Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 2262562Protein Ribosomal protein S14 [57753] (2 species)
  7. 2262588Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 2262605Domain d2uxdn1: 2uxd N:2-61 [152294]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d1fjgn_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdn1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (N:) ribosomal protein s14

SCOPe Domain Sequences for d2uxdn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2uxdn1:

Click to download the PDB-style file with coordinates for d2uxdn1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdn1: