Lineage for d1fsla_ (1fsl A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903171Protein Leghemoglobin [46481] (2 species)
  7. 903172Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)
  8. 903173Domain d1fsla_: 1fsl A: [15229]
    complexed with hem, nio

Details for d1fsla_

PDB Entry: 1fsl (more details), 2.3 Å

PDB Description: ferric soybean leghemoglobin complexed with nicotinate
PDB Compounds: (A:) leghemoglobin a

SCOPe Domain Sequences for d1fsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

SCOPe Domain Coordinates for d1fsla_:

Click to download the PDB-style file with coordinates for d1fsla_.
(The format of our PDB-style files is described here.)

Timeline for d1fsla_: