Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Leghemoglobin [46481] (2 species) |
Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries) |
Domain d1fsla_: 1fsl A: [15229] complexed with hem, nio |
PDB Entry: 1fsl (more details), 2.3 Å
SCOPe Domain Sequences for d1fsla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk wsdelsrawevaydelaaaikka
Timeline for d1fsla_: