Lineage for d2uxdg1 (2uxd G:2-156)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331851Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2331852Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2331853Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2331854Protein Ribosomal protein S7 [47975] (4 species)
  7. 2331884Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2331898Domain d2uxdg1: 2uxd G:2-156 [152287]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d1fjgg_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdg1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (G:) ribosomal protein s7

SCOPe Domain Sequences for d2uxdg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2uxdg1:

Click to download the PDB-style file with coordinates for d2uxdg1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdg1: