Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d2uxbs1: 2uxb S:2-81 [152280] Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbm1, d2uxbn1, d2uxbq1, d2uxbr1, d2uxbt1, d2uxbu1 automatically matched to d1ibms_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxb (more details), 3.1 Å
SCOPe Domain Sequences for d2uxbs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxbs1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d2uxbs1: