Lineage for d2uxbs1 (2uxb S:2-81)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070170Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1070254Domain d2uxbs1: 2uxb S:2-81 [152280]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbm1, d2uxbn1, d2uxbq1, d2uxbr1, d2uxbt1, d2uxbu1
    automatically matched to d1ibms_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbs1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (S:) ribosomal protein s19

SCOPe Domain Sequences for d2uxbs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbs1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2uxbs1:

Click to download the PDB-style file with coordinates for d2uxbs1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbs1: