Lineage for d1lh6a_ (1lh6 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759552Protein Leghemoglobin [46481] (2 species)
  7. 759558Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 759575Domain d1lh6a_: 1lh6 A: [15228]
    complexed with hem, nac

Details for d1lh6a_

PDB Entry: 1lh6 (more details), 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
PDB Compounds: (A:) leghemoglobin a (nicotinate met)

SCOP Domain Sequences for d1lh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lh6a_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d1lh6a_:

Click to download the PDB-style file with coordinates for d1lh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1lh6a_: