Lineage for d1lh6__ (1lh6 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 509Protein Leghemoglobin [46481] (2 species)
  7. 515Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 532Domain d1lh6__: 1lh6 - [15228]

Details for d1lh6__

PDB Entry: 1lh6 (more details), 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)

SCOP Domain Sequences for d1lh6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lh6__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d1lh6__:

Click to download the PDB-style file with coordinates for d1lh6__.
(The format of our PDB-style files is described here.)

Timeline for d1lh6__: