Lineage for d2uxbo1 (2uxb O:2-89)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070170Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1070252Domain d2uxbo1: 2uxb O:2-89 [152276]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbm1, d2uxbn1, d2uxbq1, d2uxbr1, d2uxbt1, d2uxbu1
    automatically matched to d1eg0f_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbo1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (O:) ribosomal protein s15

SCOPe Domain Sequences for d2uxbo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbo1 i.1.1.1 (O:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2uxbo1:

Click to download the PDB-style file with coordinates for d2uxbo1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbo1: