Lineage for d2uxbl1 (2uxb L:5-128)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897053Domain d2uxbl1: 2uxb L:5-128 [152273]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbm1, d2uxbn1, d2uxbq1, d2uxbr1, d2uxbt1, d2uxbu1
    automatically matched to d1gixo_
    complexed with k, mg, par, zn

Details for d2uxbl1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (L:) ribosomal protein s12

SCOP Domain Sequences for d2uxbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbl1 i.1.1.1 (L:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d2uxbl1:

Click to download the PDB-style file with coordinates for d2uxbl1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbl1: