![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
![]() | Domain d2uxbk1: 2uxb K:11-126 [152272] Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1 automatically matched to d1i94k_ complexed with k, mg, par, zn |
PDB Entry: 2uxb (more details), 3.1 Å
SCOP Domain Sequences for d2uxbk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxbk1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
Timeline for d2uxbk1: