![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
![]() | Domain d2uxbj1: 2uxb J:3-100 [152271] Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1 automatically matched to d1fjgj_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxb (more details), 3.1 Å
SCOPe Domain Sequences for d2uxbj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxbj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d2uxbj1: