Lineage for d1lh5__ (1lh5 -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (18 proteins) 
Protein Leghemoglobin [46481] (2 species) Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) 
Domain d1lh5__: 1lh5 - [15227]
Details for d1lh5__
PDB Entry: 1lh5 (more details), 2 Å
PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
SCOP Domain Sequences for d1lh5__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lh5__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa
SCOP Domain Coordinates for d1lh5__:
Click to download the PDB-style file with coordinates for d1lh5__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lh5__:
- d1lh5__ first appeared (with stable ids) in SCOP 1.55
- d1lh5__ appears in SCOP 1.59
- d1lh5__ appears in SCOP 1.63
- d1lh5__ appears in the current release, SCOPe 2.08, called d1lh5a_
View in 3D