Lineage for d2uxbh1 (2uxb H:1-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670846Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1670847Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 1670848Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1670849Protein Ribosomal protein S8 [56049] (4 species)
  7. 1670867Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1670897Domain d2uxbh1: 2uxb H:1-138 [152269]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1
    automatically matched to d1fjgh_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbh1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (H:) ribosomal protein s8

SCOPe Domain Sequences for d2uxbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2uxbh1:

Click to download the PDB-style file with coordinates for d2uxbh1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbh1: