![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.3: Small subunit [58132] (1 protein) |
![]() | Protein 30S subunit [58133] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
![]() | Domain d2uxbe1: 2uxb E:5-154 [152266] Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1 automatically matched to d1fkae_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxb (more details), 3.1 Å
SCOPe Domain Sequences for d2uxbe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxbe1 i.1.1.3 (E:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg srnpiniayatmealrqlrtkadverlrkg
Timeline for d2uxbe1: