Lineage for d2ux4l_ (2ux4 L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579961Protein automated matches [190224] (10 species)
    not a true protein
  7. 2579980Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)
  8. 2580018Domain d2ux4l_: 2ux4 L: [152254]
    Other proteins in same PDB: d2ux4h1, d2ux4h2
    automated match to d1aigl_
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux4l_

PDB Entry: 2ux4 (more details), 2.51 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the charge-separated state, 2nd dataset
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2ux4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux4l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2ux4l_:

Click to download the PDB-style file with coordinates for d2ux4l_.
(The format of our PDB-style files is described here.)

Timeline for d2ux4l_: