Class g: Small proteins [56992] (90 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein CD59 [57355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57356] (8 PDB entries) |
Domain d2ux2c1: 2ux2 C:1-77 [152251] automatically matched to d1cdqa_ |
PDB Entry: 2ux2 (more details), 1.8 Å
SCOP Domain Sequences for d2ux2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux2c1 g.7.1.3 (C:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]} lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt yycckkdlcnfneqlen
Timeline for d2ux2c1: