Lineage for d2lh6__ (2lh6 -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148821Protein Leghemoglobin [46481] (2 species)
  7. 148827Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 148843Domain d2lh6__: 2lh6 - [15225]

Details for d2lh6__

PDB Entry: 2lh6 (more details), 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)

SCOP Domain Sequences for d2lh6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lh6__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d2lh6__:

Click to download the PDB-style file with coordinates for d2lh6__.
(The format of our PDB-style files is described here.)

Timeline for d2lh6__: