Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Streptococcus suis [TaxId:1307] [101134] (4 PDB entries) |
Domain d2ux1f1: 2ux1 F:22-172 [152242] automatically matched to d1umng_ complexed with ca, cl, epe, zn; mutant |
PDB Entry: 2ux1 (more details), 1.8 Å
SCOP Domain Sequences for d2ux1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux1f1 a.25.1.1 (F:22-172) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd svtndifnvakasiekhiwmlqaelgqapkl
Timeline for d2ux1f1: