Lineage for d2ux1d1 (2ux1 D:22-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766502Species Streptococcus suis [TaxId:1307] [101134] (4 PDB entries)
  8. 766518Domain d2ux1d1: 2ux1 D:22-172 [152240]
    automatically matched to d1umng_
    complexed with ca, cl, epe, zn; mutant

Details for d2ux1d1

PDB Entry: 2ux1 (more details), 1.8 Å

PDB Description: identification of two zinc-binding sites in the streptococcus suis dpr protein
PDB Compounds: (D:) DNA protection during starvation protein

SCOP Domain Sequences for d2ux1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux1d1 a.25.1.1 (D:22-172) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d2ux1d1:

Click to download the PDB-style file with coordinates for d2ux1d1.
(The format of our PDB-style files is described here.)

Timeline for d2ux1d1: