SCOPe 2.01: Domain d2lh3a_: 2lh3 A:

Lineage for d2lh3a_ (2lh3 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)

8. Domain d2lh3a_: 2lh3 A: [15224]
   complexed with cyn, hem

Details for d2lh3a_

PDB Entry: 2lh3, 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)

PDB Compounds: (A:) leghemoglobin (cyano met)

SCOPe Domain Sequences for d2lh3a_:

Sequence; same for both SEQRES and ATOM records:

>d2lh3a_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

Timeline for d2lh3a_:

• d2lh3a_ first appeared (with stable ids) in SCOP 1.55, called d2lh3__
  
• d2lh3a_ appears in SCOP 1.75
  
• d2lh3a_ appears in SCOPe 2.02
  
• d2lh3a_ appears in the current release, SCOPe 2.08