Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (9 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries) |
Domain d2uwwl_: 2uww L: [152229] Other proteins in same PDB: d2uwwh1, d2uwwh2 automated match to d1aigl_ complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2 |
PDB Entry: 2uww (more details), 2.05 Å
SCOPe Domain Sequences for d2uwwl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwwl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d2uwwl_: