Lineage for d2uwwl_ (2uww L:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239027Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1239028Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1239029Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1239184Protein automated matches [190224] (5 species)
    not a true protein
  7. 1239196Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries)
  8. 1239208Domain d2uwwl_: 2uww L: [152229]
    automated match to d1aigl_
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uwwl_

PDB Entry: 2uww (more details), 2.05 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the neutral state
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2uwwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwwl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2uwwl_:

Click to download the PDB-style file with coordinates for d2uwwl_.
(The format of our PDB-style files is described here.)

Timeline for d2uwwl_: