SCOPe 2.08: Domain d2uwtl_: 2uwt L:

Lineage for d2uwtl_ (2uwt L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)

8. Domain d2uwtl_: 2uwt L: [152223]
   Other proteins in same PDB: d2uwth1, d2uwth2
   automated match to d1aigl_
   complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uwtl_

PDB Entry: 2uwt, 2.5 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the charge-separated state 2nd dataset

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2uwtl_:

Sequence; same for both SEQRES and ATOM records:

>d2uwtl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2uwtl_:

• d2uwtl_ first appeared in SCOP 1.75, called d2uwtl1
  
• d2uwtl_ appears in SCOPe 2.07